DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and cd80

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_031752272.1 Gene:cd80 / 101733943 -ID:- Length:264 Species:Xenopus tropicalis


Alignment Length:190 Identity:42/190 - (22%)
Similarity:69/190 - (36%) Gaps:49/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWIIALL-LGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKC--------THNVRPEILFKVTW 59
            |.:.|:| .|:.:..||:.|  |..:.::|..|...|.:.::.        .|..|..::|..:.
 Frog    14 FVLCAVLSAGVARQVPISAQ--VGASAILPCDVPTPSDSQWETLRLFVQRQNHGDRETVVFSFSE 76

  Fly    60 LKVDKGKFFEFINGRNPPFR-NSTIEGAEI-DWDNSNEQQVTLKDVQFDLSGQFYCEV------S 116
            .....|........|...|| |:::..:.| .||                .||:.|.|      .
 Frog    77 NAEQTGHQTPRYRNRTHLFRHNASLSLSHIHPWD----------------EGQYVCHVFLRDKGE 125

  Fly   117 TDTPIFTKASADELMSVFLPQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLI 176
            ...|:.||.|    :||: .....|.|:.|.      ||   |.|.:..|.|...::|.:
 Frog   126 YQPPLTTKLS----LSVW-ADFSKPMIEERD------GE---AECVSVGGFPEGRLSWTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 18/102 (18%)
IG_like 34..118 CDD:214653 17/99 (17%)
Ig 141..>183 CDD:299845 10/36 (28%)
cd80XP_031752272.1 Ig 24..118 CDD:416386 21/111 (19%)
FR1 24..43 CDD:409353 5/20 (25%)
putative Ig strand A 24..27 CDD:409353 0/2 (0%)
Ig strand A' 30..33 CDD:409353 1/2 (50%)
Ig strand B 38..42 CDD:409353 0/3 (0%)
CDR1 44..50 CDD:409353 2/5 (40%)
CDR2 72..87 CDD:409353 2/14 (14%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 79..82 CDD:409353 0/2 (0%)
FR3 88..118 CDD:409353 10/45 (22%)
Ig strand D 91..95 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig <154..217 CDD:416386 5/18 (28%)
Ig strand C 165..172 CDD:409353 1/7 (14%)
Ig strand C' 174..176 CDD:409353
Ig strand D 181..188 CDD:409353
Ig strand E 192..202 CDD:409353
Ig strand F 206..215 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083437at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.