DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VII and si:dkey-22i16.9

DIOPT Version :9

Sequence 1:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_003197745.2 Gene:si:dkey-22i16.9 / 100536567 ZFINID:ZDB-GENE-090313-261 Length:448 Species:Danio rerio


Alignment Length:159 Identity:31/159 - (19%)
Similarity:57/159 - (35%) Gaps:52/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRFW------IIALLLGLQQTKP---------INGQSDVLVNLVVPRYVERGSSATFKCTHNVR 50
            :|..|      ::.:|.|:.:..|         :....|..::|.: ....|..:..::|.|...
Zfish   156 VNILWKKDDQVVLQVLNGIIKYGPRFTDRASVSLKDYKDGELSLTI-HNASRSDAGLYQCYHKPS 219

  Fly    51 PE-----------ILFKVTWLKVDKGKFFEFINGRNPPFRNSTIEGAEIDWDNSNEQQVTLKDVQ 104
            .|           ...:::|.|    ||     |.|.|          :|..:|:   ||:..:.
Zfish   220 EEHGHPGAVTLHVAALEISWTK----KF-----GENLP----------LDLFSSD---VTISFIG 262

  Fly   105 FDLSGQFYCEVSTDTPIFTKASADELMSV 133
            .|.|.:..|.|..::   ||.|:|.:..|
Zfish   263 SDESEKQVCTVMGNS---TKCSSDYINRV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VIINP_733162.2 Ig 31..118 CDD:299845 19/97 (20%)
IG_like 34..118 CDD:214653 19/94 (20%)
Ig 141..>183 CDD:299845
si:dkey-22i16.9XP_003197745.2 IG_like 30..>110 CDD:214653
IG_like 128..232 CDD:214653 11/76 (14%)
Ig 137..214 CDD:299845 8/58 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1083437at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.