powered by:
Protein Alignment Tb and CG34305
DIOPT Version :9
Sequence 1: | NP_651494.1 |
Gene: | Tb / 43212 |
FlyBaseID: | FBgn0243586 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097671.1 |
Gene: | CG34305 / 5740825 |
FlyBaseID: | FBgn0085334 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 27/47 - (57%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 PEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFAT 223
|.|..::|:..:|..|.||.|..:|||:||.:..:....|.:::.|:
Fly 28 PTVSVLRYKDDRDLANIQRAIIAQYERIGGTTKVHQPLTANIVNPAS 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tb | NP_651494.1 |
DM5 |
86..187 |
CDD:214776 |
3/9 (33%) |
CG34305 | NP_001097671.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000952 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.