DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlD

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:292 Identity:120/292 - (41%)
Similarity:148/292 - (50%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVA-RADVGGYNYG--AGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGG-- 60
            ||.||:..:|||: .||..||||.  |....|.|...||                  |.:.|.  
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGS------------------GQVIGELP 47

  Fly    61 ----SISGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRV 121
                .:..|............:...||:..||.|||::|:|||..:::..|...:|.:|||||||
  Fly    48 SQVLPVQSGEAVLSQPIEAPVAPQIAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRV 112

  Fly   122 VFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRT 186
            ||||.|||:|.|.|||.||||:|:|:|||||||||.|:|:||.||..|...|.:|||||||||||
  Fly   113 VFIRTPENQGFERAALQLAKQSAQQETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRT 177

  Fly   187 QQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSG 251
            .:||.|||..||.:|.:|.|.|...|.|.||||:||:...|                        
  Fly   178 PEDAANAQLAIQNQYNQLPGVSRISNEGRAPVLNFASSPAQ------------------------ 218

  Fly   252 SVSAELEAPSAGYIPP-PAAAPSATYLPVNKV 282
                      |..||. .|||||:.|||.|.|
  Fly   219 ----------AAAIPAVAAAAPSSEYLPANVV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 63/100 (63%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 63/99 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.