DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlS

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:205 Identity:65/205 - (31%)
Similarity:95/205 - (46%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDN----KSVSDLAATLKKNLRVVFIRAPENKGLE 133
            |||..:|           |:|||:||..|  |.    :|..:||..|....:|||||.||.    
  Fly    43 SGGKLAT-----------EYFTYAAPPED--DQVAPWQSARELAKVLSPPQQVVFIRTPET---- 90

  Fly   134 NAALALAKQ-AAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTI 197
            |.....||| |......|:||.:|.|..:||.|...:....:.||.||||||||..|...|...:
  Fly    91 NIFTLTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSAL 155

  Fly   198 QQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQ-----QQQQQQVQLIDERRPSSGSVSAEL 257
            :.:|:||.|.|.|:      .::.|..||.:.:..:     :.:.:.....:...|:|...:|:|
  Fly   156 RSDYDRLPGNSISH------AIEKADVVQLKPQTTETPVIFKIRPKDSDYYETHEPASELETAKL 214

  Fly   258 EAPSAGYIPP 267
            :|....|:||
  Fly   215 QALFREYLPP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 41/105 (39%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 43/116 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.