DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlN

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:324 Identity:132/324 - (40%)
Similarity:171/324 - (52%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVARADVGGYNY--------------GAGI----GSGGSI----SGGSLSGGSIS 43
            ||.|::..::|:|.||..||||              |:|.    |.|||:    |.|||..|..|
  Fly     1 MRAFVVLCLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGAS 65

  Fly    44 G----------GSISG--GSISGGSIS------GGSISGGSLSSGSLSGGSYSTNY--------- 81
            |          ||:.|  |.:.||||.      |.|..|..|.|..|..|..|:..         
  Fly    66 GSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGLGSSGLGSGLGSSGLGSGLGSAGL 130

  Fly    82 -APVN-------TEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENKGLENAALA 138
             |||:       .|..||||||:|.|.||::.:::..:|:::.|.||||||:.|||:||||||||
  Fly   131 SAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGLENAALA 195

  Fly   139 LAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYER 203
            ||||||:|:||||||.||.|:..||.:|..:...|.:|||||||||||.:||.||||.||.:|::
  Fly   196 LAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRAIQSQYDQ 260

  Fly   204 LGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSV-SAELEAPSAGYIP 266
            |||:|.:.|||||..|:||                          |:|.| .|..:.|...|:|
  Fly   261 LGGSSQAINGGVANALNFA--------------------------SAGPVRQATAQIPENSYLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 60/100 (60%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 60/100 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.