DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlO

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:280 Identity:116/280 - (41%)
Similarity:148/280 - (52%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISGG 65
            ||..|.|.::..|.|.   ||||||.....|.:..|.||.|:                      |
  Fly     1 MRFLIAFCLIGAACAQ---YNYGAGFTGAASDNVPSYSGSSV----------------------G 40

  Fly    66 SLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENK 130
            ....|:.|...||     |::|.|||::|:.|.|:.|||..:...:|.::.|.||||||:.|||:
  Fly    41 DSYDGAASSPDYS-----VSSELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENR 100

  Fly   131 GLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQR 195
            ||||||||||||||||:||||||.||.|:..||.:.......|..:||||||||||.:||.||||
  Fly   101 GLENAALALAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQR 165

  Fly   196 TIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAELEAP 260
            .||.:|:.|||:|.|.|||||..::||:               ...::..||..:.|        
  Fly   166 AIQSQYDNLGGSSQSINGGVANAINFAS---------------AAPVVPARRGPNYS-------- 207

  Fly   261 SAGYIPPPAAAPSATYLPVN 280
                  |||||.|.:|||.|
  Fly   208 ------PPAAATSNSYLPAN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 58/100 (58%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 58/100 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.