DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlL

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster


Alignment Length:304 Identity:143/304 - (47%)
Similarity:179/304 - (58%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVARADVGGYNY--------------GAGIGSGGSISGGSLSGGSISGGSISGGS 51
            ||.||:..::|||.||..||||              |:|...||||.|||:.||||.||||.||.
  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGL 65

  Fly    52 ISGGSISGGSISGGSLSSGSLSGGSYSTNY----------------APVN-------TEFNKEFF 93
            |.||||.||||.|||| .||:.|||..:..                |||:       .|..||||
  Fly    66 IGGGSIGGGSIGGGSL-GGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFF 129

  Fly    94 TYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGD 158
            ||||.|.||::.:.:..:|.::.|.||||||:.|||:||||||||||||||:|:||||||.||.|
  Fly   130 TYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQAD 194

  Fly   159 LSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFAT 223
            :..||.:|..:.:.:.:|||||||||||.:||.||||.||.:|::|||:|.::||||||.|:|| 
  Fly   195 IGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNFA- 258

  Fly   224 KVQQQQEQQQQQQQQQVQLIDERRPSSGSV-SAELEAPSAGYIP 266
                                     |:|.| .|..:.|...|:|
  Fly   259 -------------------------SAGPVQKANAQIPENAYLP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 60/100 (60%)
TwdlLNP_733158.1 DM5 122..223 CDD:214776 60/100 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.