DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlP

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:281 Identity:106/281 - (37%)
Similarity:143/281 - (50%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVARA-DVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISG 64
            ||..||.:::|.|.| .:.|||||.|..:                                ||.|
  Fly     1 MRALIILSIVAAASAGSLSGYNYGQGATT--------------------------------SIGG 33

  Fly    65 GSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPEN 129
            ..:|......|..|.:.|| ....:|||:::.|.:.||||..::....|::|||:||:||::|||
  Fly    34 SGVSPVPALAGPVSYSAAP-QASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPEN 97

  Fly   130 KGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQ 194
            :|.|||.||||||||:||||||||.||.|::.||.:...:...:..|||||||||||.:||.|||
  Fly    98 RGYENAVLALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQ 162

  Fly   195 RTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAELEA 259
            |.||.:|::|||:|.|.|||||..::||                          |.|:..|.:  
  Fly   163 RAIQSQYDQLGGSSQSINGGVANAINFA--------------------------SQGAAPARV-- 199

  Fly   260 PSAGYIPPPAAAPSATYLPVN 280
                   .|...|.:.|||.|
  Fly   200 -------TPQQVPQSNYLPAN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 54/100 (54%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 51/94 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.