DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlG

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:315 Identity:94/315 - (29%)
Similarity:139/315 - (44%) Gaps:75/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISGG 65
            |..||:..:|.:|.....||||.|......|...|.|...||.    ...:::..:|...::...
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIP----QFATLAEQTILQQALQAP 61

  Fly    66 SLSSGSLSGG----SYS------------TNYAPVNTEFN---------------KEFFTYSAPE 99
            .|.. .|:||    |||            |.:.| |:.:|               |:.:.:..|.
  Fly    62 KLQQ-VLTGGEGLASYSNQNQASAYQQQATQFGP-NSAYNALPQAHQPQQQHLVSKDIYVHVPPA 124

  Fly   100 ADFEDNKSVSDL-AATLKKNLRVVFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLA 163
            .:.||......| .|..:|:.|:|||:|| ...:..|||.:.:...|::|.||||||:.|...|.
  Fly   125 EEPEDRYPQPVLPPAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQ 188

  Fly   164 NQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQ 228
            ..::.:.....|||||.|:||:||::|.:||||||.:|::|||.|...:.|||||    |.|   
  Fly   189 TAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPV----TSV--- 246

  Fly   229 QEQQQQQQQQQVQLIDERRP---SSGSVSAELEAPSAGYIPPPAAAPSATYLPVN 280
                       :.::|.:|.   |||..|..|              |: :|||.|
  Fly   247 -----------IGVLDNQRNNGISSGQFSGSL--------------PN-SYLPTN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 35/116 (30%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.