DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlF

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:228 Identity:73/228 - (32%)
Similarity:121/228 - (53%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VNTEF-------NKEFFTYSAPEADFE---DNKSVSDLAATLKKNLRVVFIRAP-ENKGLENAAL 137
            :.|:|       .|:.:.:||||.:.|   |...:.::  .::||.|:|||:|| :|.....|||
  Fly   128 LQTQFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENV--PIRKNYRIVFIKAPSQNLKYTAAAL 190

  Fly   138 ALAKQAAEQQTAIYVLTKQGDLSSLANQLQ-NLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEY 201
            ..|:.:.|::|.||||:|:.||:.:..||| ..:.....||||:|:||:||::|..||:.||.:|
  Fly   191 KRAQSSNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQY 255

  Fly   202 ERLGGASTSYNGGVAPV-------LDFATKVQQQQE--------------QQQQQQQQQVQLIDE 245
            :.||||:...:.||||:       |:..:.|.|..:              |.|.|...|:|.|::
  Fly   256 DALGGATHISDEGVAPIASVSSGSLNLGSFVPQHSQAGQTIIHSQAPTIIQPQGQPIVQLQSINQ 320

  Fly   246 RRPSSGSVSAELEAPSAGYIPPPAAAPSATYLP 278
            ........|:.::..::.:.|   :|||..|:|
  Fly   321 GVQGVQQQSSFVQKSTSSFAP---SAPSRKYVP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 41/112 (37%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 39/105 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.