DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlX

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:375 Identity:112/375 - (29%)
Similarity:157/375 - (41%) Gaps:122/375 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRGFIIFAVLAV-------ARADV---GGYNYGAGIGSGGSISGGSLS----------------- 38
            |:.|::.|||||       .|.||   .||:|.||..:|..::...||                 
  Fly     1 MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAPLTTVTTSYQPTAAGT 65

  Fly    39 --------------GGSISGGSIS---GGSIS-----GGSISGGSISGGSLSSGSLSGG------ 75
                          |.|.|.|.::   |||.|     |.|..||.|...::....|..|      
  Fly    66 NYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYN 130

  Fly    76 ------SYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDL-AATLKKNLRVVFIRAPENKGLE 133
                  |:..|:.|  .:.||.|:.:|||| |.::.:.|..: ....:||.|||||.||.:..  
  Fly   131 EQESYISHLANFQP--AQINKHFYIHSAPE-DHDEQQIVRYVNVGRPQKNYRVVFINAPTSTA-- 190

  Fly   134 NAALALAKQA-AEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTI 197
            :.|..:|..| .|::||||||:|:.:...:..::.....| |:||||.||||:|.|:|.:||:||
  Fly   191 SKAKIIANVAPVEEKTAIYVLSKKSNALDVTAEVVTQRPV-ANKPEVFFVKYKTPQEAAHAQQTI 254

  Fly   198 QQEYERLGGASTSYNGGVAPVLDF--------ATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVS 254
            |..|:.|||:|.:.|.||.||...        |:.|                |.|    :||||:
  Fly   255 QANYDALGGSSETSNEGVIPVSSVIGSLGDNGASGV----------------LTD----ASGSVN 299

  Fly   255 AELEAPSAGYIPPPAAAPS---------------------ATYLPVNKVK 283
                ....|.:|...|..|                     ||||||..|:
  Fly   300 ----IVGTGGVPTVDAGASYDAEGSQRQVISTVTTGTNAQATYLPVKPVR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 39/102 (38%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.