DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlY

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:243 Identity:82/243 - (33%)
Similarity:113/243 - (46%) Gaps:45/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ISGGSISGGSIS-GGSISGGSLSSGSLSGGS-----YSTNYAPVNTEFNKEFFTYSAPEADFEDN 105
            |.|||...|.:. |||..||.:|.....||.     .||..||:   .||:|:..||||....|.
  Fly    34 IGGGSAPVGGVGIGGSSGGGLVSIQPHRGGDKYLPPASTTLAPI---INKKFYLVSAPEDHSNDG 95

  Fly   106 KSVSDLAATLKKNLRVVFIRAPENKGLENAALALAKQAA--EQQTAIYVLTKQG---DLSSLANQ 165
            |....:....:||.|||||:||..   :||.:..:.:.|  |::|.||||:|:.   |.|.:|..
  Fly    96 KVKHLVLGRPQKNYRVVFIKAPAG---DNANVKYSAEFAPQEEKTVIYVLSKKDNDVDASDIATP 157

  Fly   166 LQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQE 230
            ..    ...|||||.|:||:|..:|..||:.||.:|::|||.:.......||:    |.|     
  Fly   158 AP----TQPSKPEVFFIKYKTDDEAKQAQQEIQGQYDKLGGTNEYQEDNNAPI----TSV----- 209

  Fly   231 QQQQQQQQQVQLIDERRPSSGSVSAELEAPSAGYIPPPAAAPSATYLP 278
                     :..:|...| .||.:....|..     |||..|::.|||
  Fly   210 ---------IGSLDGLNP-DGSYNYRQIANR-----PPAVVPNSQYLP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 39/105 (37%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 40/108 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.