DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tb and TwdlZ

DIOPT Version :9

Sequence 1:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:203 Identity:62/203 - (30%)
Similarity:91/203 - (44%) Gaps:14/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SLSSGSLSGGSYSTNYAPVNTE----FNKEFFTYSAPEADFED--NKSVSDLAATLKKNLRVVFI 124
            |||..|||....|....|.|..    ..|:|::.| |..|.||  .::...:....::|.||:||
  Fly     9 SLSLISLSWAQGSRYLPPPNPAMEPIITKQFYSIS-PAEDPEDLEPRTKHLVIGQPRRNYRVIFI 72

  Fly   125 RAPENKGLENAALALAKQAAEQQTAIYVLT-KQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQ 188
            |||.... |:..........|::|.||||| ||.:|.:..............||:|.|:||:|..
  Fly    73 RAPTGNS-EHVKYTAELAPQEERTVIYVLTRKQQELEAADIMAPQQKSQVEQKPDVFFIKYKTND 136

  Fly   189 DAINAQRTIQQEYERLGG---ASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSS 250
            :|..|||.||.:|::|||   .:..|...:..|:...:..|........|:|......|  ||..
  Fly   137 EAAAAQREIQTQYDQLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHYD--RPDR 199

  Fly   251 GSVSAELE 258
            .::.|.:|
  Fly   200 STILAPVE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbNP_651494.1 DM5 86..187 CDD:214776 32/107 (30%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.