DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and CG34305

DIOPT Version :10

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001097671.1 Gene:CG34305 / 5740825 FlyBaseID:FBgn0085334 Length:79 Species:Drosophila melanogaster


Alignment Length:59 Identity:15/59 - (25%)
Similarity:28/59 - (47%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRLPGNSISHAIEKADVV 177
            ||:...||    ....|:|..::|:...|:.....|:.:.|:|:.|.:..|....|::|
  Fly    16 ALSAPAAA----TDNAPTVSVLRYKDDRDLANIQRAIIAQYERIGGTTKVHQPLTANIV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 7/25 (28%)
CG34305NP_001097671.1 None

Return to query results.
Submit another query.