DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlC

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:299 Identity:63/299 - (21%)
Similarity:92/299 - (30%) Gaps:145/299 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVYLPAENEVSSGGKLATEYFTYAAPPED------------DQVAPWQSARE----------LAK 74
            ::|.|...|.|         |...|||:.            :||||..:|.|          :|.
  Fly    52 QIYQPLPQEQS---------FANFAPPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAH 107

  Fly    75 VLS-------------------------PPQ-----------------------QVVFIRTPETN 91
            .||                         ||:                       ::|||:.|...
  Fly   108 RLSGVQHASGYNNGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAP 172

  Fly    92 IFTLTAKQLAVNNPLD------IFVLHRQADADALAKQQAAIQQQVSEKPS---VHFVKYRT--- 144
                ..:|..|..|..      |:|||::.:.:    |...|......|||   |:|:||:|   
  Fly   173 ----AIRQPVVPPPPQNEEKTLIYVLHKKPEQE----QDIVIPTPPPTKPSKPEVYFIKYKTKKD 229

  Fly   145 --------PADVTRALSALRSDYDRLPGNSISHAIEKADVVQLKPQTTETPVIFKIRPKDSDYYE 201
                    ||:: ....|...|:..|           |:|..:.|.||..|.     |:.    |
  Fly   230 EAPVYGPPPAEM-EPRQATAEDFAPL-----------AEVADVLPPTTLAPA-----PEP----E 273

  Fly   202 THEPA----------------SELETAKLQALFREYLPP 224
            ..:||                .|::|. |.|...:||||
  Fly   274 VEQPAIPSAVYGPPTAAAYTGEEVQTT-LSAPANQYLPP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 36/189 (19%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.