DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlQ

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_651496.1 Gene:TwdlQ / 43214 FlyBaseID:FBgn0039448 Length:245 Species:Drosophila melanogaster


Alignment Length:186 Identity:59/186 - (31%)
Similarity:91/186 - (48%) Gaps:21/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSGGKLATEYFTYAAPPEDDQVAPWQSARELAKVLSPPQQVVFIRTPE----TNIFTLTAKQLAV 102
            ::..:.:.|::|||||  :::.|..::...:|.:|....:|:||::||    ||.....||| |.
  Fly    70 AAADEFSKEFYTYAAP--EEEFADQEATEHIASMLKRNLRVLFIKSPEHQGLTNAALQLAKQ-AS 131

  Fly   103 NNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRLPGNSI 167
            .....|:||.:|||...||::.|...|..|.||.|||||||||.|..||...::..:|.|.|:|.
  Fly   132 EQRTAIYVLSKQADVSQLAQRLANENQAQSPKPEVHFVKYRTPEDAVRAQQLIQQQFDSLGGSSR 196

  Fly   168 SHAIEKADVVQLKPQTTETPVIFKIRPKDSDYYETHEPASELETAKLQALFREYLP 223
            |.....|.|:.           |...|......|.:|..::::..   ....:|||
  Fly   197 SSDEGVAPVLD-----------FSSAPAAISVQEQNEAQNQVQAV---TPLTKYLP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 40/103 (39%)
TwdlQNP_651496.1 DM5 73..174 CDD:214776 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.