DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlD

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:236 Identity:78/236 - (33%)
Similarity:107/236 - (45%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LGFCHGLGEVY--LPAE-NEVSSGGKLAT--------------------EYFTYAAPPE--DDQV 63
            |.|..|.|:|.  ||:: ..|.||..:.:                    |:::||||.|  |:..
  Fly    33 LSFLPGSGQVIGELPSQVLPVQSGEAVLSQPIEAPVAPQIAPLVEEFQKEFYSYAAPEEQYDEGA 97

  Fly    64 APWQSARELAKVLSPPQQVVFIRTPETNIFTLTAKQLA---VNNPLDIFVLHRQADADALAKQQA 125
            :..|.|..|.|.|    :||||||||...|...|.|||   ......|:||.:|:|...||||..
  Fly    98 SNQQIANSLKKNL----RVVFIRTPENQGFERAALQLAKQSAQQETAIYVLTKQSDVSNLAKQLN 158

  Fly   126 AIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRLPGNSISHAIEKADVVQL---KPQTTETP 187
            |::...:.||.|||||||||.|...|..|:::.|::|||.|......:|.|:..   ..|....|
  Fly   159 ALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQLPGVSRISNEGRAPVLNFASSPAQAAAIP 223

  Fly   188 VIFKIRPKDSDYYETHEPASELETAKLQALFREYLPPGKRR 228
            .:....| .|:|...:..|.:           :||||..||
  Fly   224 AVAAAAP-SSEYLPANVVAGQ-----------DYLPPNLRR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 44/124 (35%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.