DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlN

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:177 Identity:63/177 - (35%)
Similarity:91/177 - (51%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GFCHGLGEVYLPAE---NEVSSGGKLATEYFTYAAPPED-DQVAPWQSARELAKVLSPPQQVVFI 85
            |...|||...|.|.   |..:...:|..|:|||.|..|| |:.   |:...:|..::...:||||
  Fly   120 GLGSGLGSAGLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEP---QALERVASSVNKGLRVVFI 181

  Fly    86 RTPET----NIFTLTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPA 146
            :.||.    |.....||| |......|:||::|||...||::..||:...:.||.|||||||||.
  Fly   182 KGPENRGLENAALALAKQ-AAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPE 245

  Fly   147 DVTRALSALRSDYDRLPGNS------ISHAIEKADVVQLKPQTTETP 187
            |...|..|::|.||:|.|:|      :::|:..|....::..|.:.|
  Fly   246 DAANAQRAIQSQYDQLGGSSQAINGGVANALNFASAGPVRQATAQIP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 41/104 (39%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443954
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.