DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlP

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:85/163 - (52%) Gaps:21/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PAENEVSSGGKLATEYFTYAAPPED--DQVAPWQSARELAKVLSPPQQVVFIRTPET----NIFT 94
            |.....:....:..|::::.|..:|  |:.|..::...:.|.:    :|:||::||.    |...
  Fly    45 PVSYSAAPQASVHKEFYSFYANDDDFEDKAALQRALASVKKNI----RVIFIKSPENRGYENAVL 105

  Fly    95 LTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDY 159
            ..||| |......|:|||:|.|.:.||::..|::|..::||.|||||||||.|...|..|::|.|
  Fly   106 ALAKQ-AAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQY 169

  Fly   160 DRLPG----------NSISHAIEKADVVQLKPQ 182
            |:|.|          |:|:.|.:.|...::.||
  Fly   170 DQLGGSSQSINGGVANAINFASQGAAPARVTPQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 35/105 (33%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 32/99 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.