DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and Twdlalpha

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:138 Identity:42/138 - (30%)
Similarity:70/138 - (50%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENEVSSGGK---LATEYFTYAAPPEDDQVAPWQSARELAKVLSPPQ---QVVFIRTPET---NIF 93
            |.||..|.:   :..::||.|||.|.:.:   :.::.|  |:..||   :||||:.|.:   |: 
  Fly   161 EQEVQRGFQEPIIHKQFFTVAAPEEHENL---ERSKHL--VIGRPQKNYRVVFIKAPSSSNANV- 219

  Fly    94 TLTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSD 158
            .|:|:.........|:||.:: |........|.....|..||.|.|:||:|.|:.:.|...::::
  Fly   220 KLSAEYAPKEEKTVIYVLSKK-DNQLEVNDIATPAPTVPSKPEVFFIKYKTDAEASHAQQQIQAE 283

  Fly   159 YDRLPGNS 166
            |||:.|.|
  Fly   284 YDRIEGTS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 30/108 (28%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.