DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlR

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:181 Identity:52/181 - (28%)
Similarity:79/181 - (43%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 APWQSAREL----AKVLSPPQ---QVVFIRTPETNIFTLTAKQLAVNNPLD---IFVLHRQADAD 118
            ||:.|..|:    .|:.|..|   |||||:.||..........||.....|   |:||::|.|.:
  Fly    77 APYDSVEEVDLAETKLSSLAQKNLQVVFIKAPENKAVVGALNALAKQTSEDKTAIYVLNKQTDVN 141

  Fly   119 ALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRLPGNSISHAIEKADVVQLKPQT 183
            .||.|.:|::.....||.||||||:|..:..:|...:::.|.  .|:||             ||.
  Fly   142 ELASQLSALKAHHKHKPQVHFVKYKTEEEAAQAQQYIQAQYG--GGSSI-------------PQP 191

  Fly   184 TETPVIFKIRPKDSDYYETHEPASELETAKL-------QALFRE---YLPP 224
            .:...: ...|:....||...|:.|....::       |:.::.   ||||
  Fly   192 GKASSL-GYYPEQQPQYEQDAPSEEYPAGQVGYLPSPQQSAYQPQSGYLPP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 34/90 (38%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.