DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlS and TwdlX

DIOPT Version :9

Sequence 1:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:123 Identity:38/123 - (30%)
Similarity:65/123 - (52%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFTYAAPPEDDQVAPWQSARELAKVLSPPQ--QVVFIRTPETNIFTLTAKQLAVNNPLD----IF 109
            ::.::||.:.|:    |.......|..|.:  :||||..|.:.  ...||.:|...|::    |:
  Fly   151 FYIHSAPEDHDE----QQIVRYVNVGRPQKNYRVVFINAPTST--ASKAKIIANVAPVEEKTAIY 209

  Fly   110 VLHRQADA-DALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRLPGNS 166
            ||.::::| |..|  :...|:.|:.||.|.||||:||.:...|...::::||.|.|:|
  Fly   210 VLSKKSNALDVTA--EVVTQRPVANKPEVFFVKYKTPQEAAHAQQTIQANYDALGGSS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlSNP_651491.1 DM5 45..145 CDD:214776 30/100 (30%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.