DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlC

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:268 Identity:61/268 - (22%)
Similarity:105/268 - (39%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YQPAASAPAVASFAPSGPSY-------------SPSVAASQ--DAPAETYAPASAPEAAPSAVAT 70
            |||.....:.|:|||...:|             :|:.||::  :|..::|..|........|...
  Fly    54 YQPLPQEQSFANFAPPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGY 118

  Fly    71 NYAAPQAELQKEFFTYTA----DEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAVALA 131
            |....:.::.|..:.:..    :|:|.::.....| .....|..:::|||.|....:....|...
  Fly   119 NNGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQ-QGPKQKHYKIVFIKAPSAPAIRQPVVPPP 182

  Fly   132 KQAGQQETAIYVLNK----QADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQD----------AL 182
            .| .:::|.||||:|    :.||     .:.:......:||||:|:||:|.:|          .:
  Fly   183 PQ-NEEKTLIYVLHKKPEQEQDI-----VIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEM 241

  Fly   183 NAQQAIQSQYDQLGGSSTIL-NGGVAPVLNFASQPAAQQVAAP---------------------S 225
            ..:||....:..|...:.:| ...:||    |.:|..:|.|.|                     |
  Fly   242 EPRQATAEDFAPLAEVADVLPPTTLAP----APEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLS 302

  Fly   226 APGSSYLP 233
            ||.:.|||
  Fly   303 APANQYLP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 26/108 (24%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.