DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and Tb

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster


Alignment Length:286 Identity:112/286 - (39%)
Similarity:158/286 - (55%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLIALCLVAAVSAR-SGYNYQP-----------AASAPAVASFAPSGPSYSPSVAASQDAPAE 53
            ||..|...::|...|. .||||..           :.|..:::..:.||.|.|   ..|....:.
  Fly     1 MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSIS---GGSISGGSI 62

  Fly    54 TYAPASAPEAAPSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGP 118
            :....|:...:..:.:||||....|..||||||:|.|.||.:......::|:|.|.|||:||:.|
  Fly    63 SGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAP 127

  Fly   119 ENTGLENAAVALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALN 183
            ||.||||||:||||||.:|:||||||.||.|:..|:|:|.::.:.:.:|||||||||||.|||:|
  Fly   128 ENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAIN 192

  Fly   184 AQQAIQSQYDQLGGSSTILNGGVAPVLNFASQPAAQQ---------------------------V 221
            ||:.||.:|::|||:||..||||||||:||::...||                           :
  Fly   193 AQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAEL 257

  Fly   222 AAPS---------APGSSYLPASVLR 238
            .|||         ||.::|||.:.::
  Fly   258 EAPSAGYIPPPAAAPSATYLPVNKVK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 57/100 (57%)
TbNP_651494.1 DM5 86..187 CDD:214776 57/100 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.