DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlD

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:258 Identity:131/258 - (50%)
Similarity:163/258 - (63%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLIALCLVA-AVSA-RSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAET-YAPASAPE 62
            ||..|.|||:| :.|| :.||||||.|.|....||.| |.........||..|.:: .|..|.|.
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLP-GSGQVIGELPSQVLPVQSGEAVLSQPI 64

  Fly    63 AAPSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAA 127
            .||  ||...|....|.||||::|.|.|:.:.|.|.:||::.||.|.|||:||:.|||.|.|.||
  Fly    65 EAP--VAPQIAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAA 127

  Fly   128 VALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQY 192
            :.||||:.|||||||||.||:|:.:|:.:||:::.::.||||||||||||.:||.|||.|||:||
  Fly   128 LQLAKQSAQQETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQY 192

  Fly   193 DQLGGSSTILNGGVAPVLNFASQPAAQQVAAP----SAPGSSYLPASVL-----------RFR 240
            :||.|.|.|.|.|.||||||||.| ||..|.|    :||.|.||||:|:           |||
  Fly   193 NQLPGVSRISNEGRAPVLNFASSP-AQAAAIPAVAAAAPSSEYLPANVVAGQDYLPPNLRRFR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 57/100 (57%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 57/99 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.