DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlS

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:193 Identity:63/193 - (32%)
Similarity:89/193 - (46%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ETYAPASAPEAAPSAVATNYAAPQAELQKEFFTYTA-DEQDFVEP-AGSQQVSASLNKALRVIFI 115
            |.|.||.           |..:...:|..|:|||.| .|.|.|.| ..:::::..|:...:|:||
  Fly    32 EVYLPAE-----------NEVSSGGKLATEYFTYAAPPEDDQVAPWQSARELAKVLSPPQQVVFI 85

  Fly   116 KGPENTGLENAAVALAKQ-AGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQ 179
            :.||.    |.....||| |......|:||::|||...|:.:..:|:...:.||.||||||||..
  Fly    86 RTPET----NIFTLTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPA 146

  Fly   180 DALNAQQAIQSQYDQLGGSSTILNGGVAPVLNFASQPAAQQVAAPSAPGSS-----YLPASVL 237
            |...|..|::|.||:|.|:|.......|.|:....|.....|.....|..|     :.|||.|
  Fly   147 DVTRALSALRSDYDRLPGNSISHAIEKADVVQLKPQTTETPVIFKIRPKDSDYYETHEPASEL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 38/103 (37%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.