DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlL

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster


Alignment Length:285 Identity:145/285 - (50%)
Similarity:169/285 - (59%) Gaps:46/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLIALCLVAAVSA-RSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAETYAPAS----- 59
            ||..|.:||||...| :.||||||...:.:..||||...|..............:....|     
  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGL 65

  Fly    60 ---------------------------------------APEAAPSAVATNYAAPQAELQKEFFT 85
                                                   ..:|..:.|:.|..||.|||||||||
  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFT 130

  Fly    86 YTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAVALAKQAGQQETAIYVLNKQADI 150
            |:|:||||.||...::|:.|:||.|||:|||||||.||||||:||||||.|||||||||||||||
  Fly   131 YSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADI 195

  Fly   151 GDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYDQLGGSSTILNGGVAPVLNFASQ 215
            |||:.|||:||||||||||||||||||.:||.|||:|||||||||||||...||||||.|||||.
  Fly   196 GDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNFASA 260

  Fly   216 PAAQQVAAPSAPGSSYLPASVLRFR 240
            ...|:..| ..|.::|||.|:.|.|
  Fly   261 GPVQKANA-QIPENAYLPTSIFRRR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 81/100 (81%)
TwdlLNP_733158.1 DM5 122..223 CDD:214776 81/100 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.