DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlW

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:316 Identity:94/316 - (29%)
Similarity:134/316 - (42%) Gaps:91/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLI-----ALCL---VAAVS-ARSGYNY-----QPAASAPAVA-----------SFAPSGPSY 40
            |::.:     |:||   .|.:| .::||||     |.....|.||           ...|...|:
  Fly     1 MKIFVTVLMGAMCLSLSQADISLTQAGYNYRIQQQQQQQQPPIVAHLLNQQLQQQQQLQPQQSSH 65

  Fly    41 S--PSVAASQDAPAETY---APASAPEAA----PSAVATNY----------AAPQAEL------Q 80
            .  |.:......||..:   .||..|.|.    |:....|:          |.|:..:      .
  Fly    66 PVLPPLPLPYLPPAGQFHSAQPAVRPTAGSFPMPAGFPVNFQTAPIQQQRRARPRVRIPKRPIVT 130

  Fly    81 KEFFTYTADEQDFVEPAGSQQVSASLNKALR-------VIFIKGPENTGLENAAVALAKQAGQQE 138
            |.||.::|.|:      ...:|...||:..:       |:|:|.|..|. ..||:.|||...|::
  Fly   131 KNFFIHSAPEE------SEDEVQDELNQLAQQPRNHYNVLFVKTPAQTN-RAAALNLAKTLKQEK 188

  Fly   139 TAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYDQLGGSSTILN 203
            |.:|||.|:....||.:.: :....:.|||||.|:||||.::|||||:.||||||.|||||||.:
  Fly   189 TVVYVLAKKTTASDLQDAI-AEAPQHINKPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTITD 252

  Fly   204 GGVAPVLN------------------------FASQPAAQQVAAPSAPGSSYLPAS 235
            .||||:.:                        ||...|......|.  |:.||||:
  Fly   253 EGVAPITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPI--GNHYLPAN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 35/113 (31%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.