DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlG

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:289 Identity:87/289 - (30%)
Similarity:130/289 - (44%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLIALCLVA-AVSARSGYNYQP----AASAPAVASFAPSGP---------------------- 38
            |...|..||:. |.....|||||.    .:||.|.....||.|                      
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQAPKLQQ 65

  Fly    39 ---------SYS-PSVAASQDAPAETYAPASAPEAAPSAVATNYAAPQAE--LQKEFFTYT--AD 89
                     ||| .:.|::....|..:.|.||..|.|.|     ..||.:  :.|:.:.:.  |:
  Fly    66 VLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQA-----HQPQQQHLVSKDIYVHVPPAE 125

  Fly    90 E------QDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAVALAKQAGQQETAIYVLNKQA 148
            |      |..:.||..:       |..|::|||.| .|.:..||:.:.:...:::|.||||.|:.
  Fly   126 EPEDRYPQPVLPPAPPR-------KHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKP 182

  Fly   149 DIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYDQLGGSSTILNGGVAPVLNFA 213
            |..||...:..|.....:||||.|:||:|.::|.:||:.||:|||||||:|.:.:.|||||.:..
  Fly   183 DPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPVTSVI 247

  Fly   214 SQPAAQQ---VAAPSAPGS---SYLPASV 236
            .....|:   :::....||   ||||.::
  Fly   248 GVLDNQRNNGISSGQFSGSLPNSYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 32/110 (29%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 32/106 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.