DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlE

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:242 Identity:66/242 - (27%)
Similarity:99/242 - (40%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLIALCLVAAVSARSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAETYAPASAPEAAP-- 65
            ||:.|..:||:.|......:.:.|||..:|:.|||||      ....|||..|.|   |:.||  
  Fly     6 VLVVLMALAALVAARPEPPRDSYSAPPSSSYQPSGPS------GGYGAPAPQYGP---PQQAPVI 61

  Fly    66 -SAVATNYAAPQAELQKEFFTYTADEQD-FVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAV 128
             ..|..:...|:.|       |.|..:. :|.|.         .|..:::|||.| :..:..|.|
  Fly    62 HKHVYVHVPPPEPE-------YQAPRKPLYVPPP---------QKHYKIVFIKAP-SPPVPTAPV 109

  Fly   129 ALAKQAGQQETAIYVLNK----QADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQ 189
            .......:::|.:|||.|    |.:|     .:.:......:||||:|::|:|            
  Fly   110 IPQFPQNEEKTLVYVLVKKPEEQPEI-----IIPTPAPTQPSKPEVYFIRYKT------------ 157

  Fly   190 SQYDQLGGSSTILNGGVAPVLNFASQPAAQQVA-----APSAPGSSY 231
             |.::.|           |..|..:.||.:..|     |||||.|||
  Fly   158 -QKEETG-----------PYPNSVAPPAPEYGAPAAPPAPSAPSSSY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 25/105 (24%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.