DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlR

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:251 Identity:85/251 - (33%)
Similarity:126/251 - (50%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIALCLVAAVSARSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAETYAPASAPEAAPSAV 68
            ::.|.|:|..||..||.||..:....|.|:.        :.|...|   |.|      .:.|.  
  Fly    14 IVFLTLLAGSSAELGYQYQQNSYGGPVNSYG--------NEAVLGD---ERY------HSQPG-- 59

  Fly    69 ATNYAAPQAELQKEFFTYTA-----DEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAV 128
              |:....|:..|.|:.:.|     :|.|..|    .::|:...|.|:|:|||.|||..:..|..
  Fly    60 --NHYQENADFHKHFYAFEAPYDSVEEVDLAE----TKLSSLAQKNLQVVFIKAPENKAVVGALN 118

  Fly   129 ALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYD 193
            |||||..:.:|||||||||.|:.:|:::|::::.::.:||:||||||:|.::|..|||.||:|| 
  Fly   119 ALAKQTSEDKTAIYVLNKQTDVNELASQLSALKAHHKHKPQVHFVKYKTEEEAAQAQQYIQAQY- 182

  Fly   194 QLGGSSTILNGGVAPVLNFASQ--------------PAAQQVAAPSAPGSSYLPAS 235
              ||.|:|...|.|..|.:..:              ||.|....||...|:|.|.|
  Fly   183 --GGGSSIPQPGKASSLGYYPEQQPQYEQDAPSEEYPAGQVGYLPSPQQSAYQPQS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 43/105 (41%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 40/99 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.