DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlX

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:125/282 - (44%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLIALCLVAA-----------VSARSGYNYQPAA-----------SAP---AVASFAP--SGP 38
            |:..:.|.::|.           ||..:||:||...           |||   ...|:.|  :|.
  Fly     1 MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAPLTTVTTSYQPTAAGT 65

  Fly    39 SY---SPSV-----AASQDAPAETY----APASAPEAAPSAV------------------ATNYA 73
            :|   :||:     .:|..:....|    :.:|:.:...|:|                  ..||.
  Fly    66 NYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYN 130

  Fly    74 APQ-----------AELQKEFFTYTADEQDFVEPAGSQQVSASLN-----KALRVIFIKGPENTG 122
            ..:           |::.|.|:.::|.|..     ..||:...:|     |..||:||..|.:|.
  Fly   131 EQESYISHLANFQPAQINKHFYIHSAPEDH-----DEQQIVRYVNVGRPQKNYRVVFINAPTSTA 190

  Fly   123 LENAAVALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQA 187
            .:...:|..... :::||||||:|:::..|::.::.:.| ...|||||.||||:|.|:|.:|||.
  Fly   191 SKAKIIANVAPV-EEKTAIYVLSKKSNALDVTAEVVTQR-PVANKPEVFFVKYKTPQEAAHAQQT 253

  Fly   188 IQSQYDQLGGSSTILNGGVAPV 209
            ||:.||.|||||...|.||.||
  Fly   254 IQANYDALGGSSETSNEGVIPV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 34/105 (32%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.