DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlH and TwdlZ

DIOPT Version :9

Sequence 1:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:191 Identity:61/191 - (31%)
Similarity:89/191 - (46%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APAETYAPASAPEAAPSAVATNYAAPQAELQKEFFTYT-ADEQDFVEPAGSQQVSASLNKALRVI 113
            |....|.|...|...|.            :.|:|::.: |::.:.:||.....|.....:..|||
  Fly    18 AQGSRYLPPPNPAMEPI------------ITKQFYSISPAEDPEDLEPRTKHLVIGQPRRNYRVI 70

  Fly   114 FIKGPENTGLENAAVALAKQAGQQE-TAIYVL-NKQADIGDLSNKLNSIRNNNNNKPEVHFVKYR 176
            ||:.|  ||........|:.|.|:| |.|||| .||.::..........::....||:|.|:||:
  Fly    71 FIRAP--TGNSEHVKYTAELAPQEERTVIYVLTRKQQELEAADIMAPQQKSQVEQKPDVFFIKYK 133

  Fly   177 TNQDALNAQQAIQSQYDQLGGSSTILNGGVAPV------LNFASQPAAQQVAAPSAPGSSY 231
            ||.:|..||:.||:|||||||::.|....|||:      |:....|||.......:||..|
  Fly   134 TNDEAAAAQREIQTQYDQLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlHNP_651490.1 DM5 77..178 CDD:214776 31/103 (30%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 29/97 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.