DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlC

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:382 Identity:83/382 - (21%)
Similarity:130/382 - (34%) Gaps:138/382 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSA----SSDAP--AFAPAPSE----SFG 59
            |.:..:|:|.|. |..||....|..:|..||..|.|..|    :...|  .:.|.|.|    :|.
  Fly     4 SSLFVVCVASLV-ATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFANFA 67

  Fly    60 P------GPSSIADALE--------------------------GSQSAAAPNYAAPQAQLEKEFF 92
            |      .|....||:|                          |.|.|:..|....:.::.|..:
  Fly    68 PPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGYNNGPQETKVHKHIY 132

  Fly    93 TYTADEGDFYDPAASDRVANAVN-------KGLRVVFIKGPENRGLEDAALALAKQAAQQETAIY 150
            .:...: ||.:   .|.:...|:       |..::||||.|....:....:....| .:::|.||
  Fly   133 VHVPPK-DFEE---EDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQ-NEEKTLIY 192

  Fly   151 VLNK----QADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQAQD 211
            ||:|    :.||     .:.:......:||||:|:||:|.:|.|..          .|......:
  Fly   193 VLHKKPEQEQDI-----VIPTPPPTKPSKPEVYFIKYKTKKDEAPV----------YGPPPAEME 242

  Fly   212 GGVASTLNFASQPAPV-QAASSQAPAQFLPASQPEA---------------------------TA 248
            ...|:..:|    ||: :.|....|....||.:||.                           :|
  Fly   243 PRQATAEDF----APLAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLSA 303

  Fly   249 PISSYVPPAT------------------------------PGSSYLPAN--ILRRLR 273
            |.:.|:||||                              |.:||.|.|  .|::|:
  Fly   304 PANQYLPPATAPAALAIEEPSMAPIVVEEQPEQRLAPSHVPATSYGPPNRYFLKKLK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 27/111 (24%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.