DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlQ

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651496.1 Gene:TwdlQ / 43214 FlyBaseID:FBgn0039448 Length:245 Species:Drosophila melanogaster


Alignment Length:261 Identity:108/261 - (41%)
Similarity:148/261 - (56%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSI 65
            ||.|   |.|.|.....|.|||||||..|...     :.:|...::|..|:...::.        
  Fly     1 MRGF---LLLLLIASVSAAKLGYNYQAAAGDR-----RFAGLIDAEATGFSSTSTQQ-------- 49

  Fly    66 ADALEGSQSAAAPN----YAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGP 126
            ....:..|.....|    ..|...:..|||:||.|.|.:|.|..|::.:|:.:.:.|||:|||.|
  Fly    50 QQQQQAQQELVQQNTQQQIPAAADEFSKEFYTYAAPEEEFADQEATEHIASMLKRNLRVLFIKSP 114

  Fly   127 ENRGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAAN 191
            |::||.:|||.|||||::|.||||||:||||:..||.:|.:.....:.|||||||||||||||..
  Fly   115 EHQGLTNAALQLAKQASEQRTAIYVLSKQADVSQLAQRLANENQAQSPKPEVHFVKYRTPEDAVR 179

  Fly   192 AQSAIQGQYDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPP 256
            ||..||.|:|.|||||::.|.|||..|:|:|.||.: :...|..||    :|.:|..|::.|:|.
  Fly   180 AQQLIQQQFDSLGGSSRSSDEGVAPVLDFSSAPAAI-SVQEQNEAQ----NQVQAVTPLTKYLPA 239

  Fly   257 A 257
            |
  Fly   240 A 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 53/100 (53%)
TwdlQNP_651496.1 DM5 73..174 CDD:214776 53/100 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.