DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and Tb

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster


Alignment Length:286 Identity:124/286 - (43%)
Similarity:163/286 - (56%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSI 65
            ||.|  ::...||| ||||..||||.....|...:|   .||.|..:.:.......|...|..|.
  Fly     1 MRGF--IIFAVLAV-ARADVGGYNYGAGIGSGGSIS---GGSLSGGSISGGSISGGSISGGSISG 59

  Fly    66 ADALEGSQSAA-------APNYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFI 123
            .....||.|:.       :.|||....:..||||||:|.|.||.|..:...:|..:.|.||||||
  Fly    60 GSISGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFI 124

  Fly   124 KGPENRGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPED 188
            :.|||:|||:||||||||||:|:||||||.||.|:..|||:|.::.:.:.:|||||||||||.:|
  Fly   125 RAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQD 189

  Fly   189 AANAQSAIQGQYDQLGGSSQAQDGGVASTLNFAS---QPAPVQAASSQAPAQFLPASQP------ 244
            |.|||..||.:|::|||:|.:.:||||..|:||:   |....|....|...|.:...:|      
  Fly   190 AINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVS 254

  Fly   245 -EATAPISSYVPP--ATPGSSYLPAN 267
             |..||.:.|:||  |.|.::|||.|
  Fly   255 AELEAPSAGYIPPPAAAPSATYLPVN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 59/100 (59%)
TbNP_651494.1 DM5 86..187 CDD:214776 59/100 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.