DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlD

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:275 Identity:141/275 - (51%)
Similarity:180/275 - (65%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQP-SGSASSDAPAFAPAPSESFGPGPSS 64
            ||.| :|||| |||...|||||||||||||:..||||.| ||....:.|: ...|.:|   |.:.
  Fly     1 MRAF-IVLCL-LAVSCSADKLGYNYQPVAHADEGLSFLPGSGQVIGELPS-QVLPVQS---GEAV 59

  Fly    65 IADALEGSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENR 129
            ::..:|   :..||..|....:.:|||::|.|.|..:.:.|::.::||::.|.||||||:.|||:
  Fly    60 LSQPIE---APVAPQIAPLVEEFQKEFYSYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQ 121

  Fly   130 GLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQS 194
            |.|.|||.||||:||||||||||.||:|:.:||.:||:::.::.||||||||||||||||||||.
  Fly   122 GFERAALQLAKQSAQQETAIYVLTKQSDVSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQL 186

  Fly   195 AIQGQYDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPP-AT 258
            |||.||:||.|.|:..:.|.|..|||||.||  |||:..|.|         |.||.|.|:|. ..
  Fly   187 AIQNQYNQLPGVSRISNEGRAPVLNFASSPA--QAAAIPAVA---------AAAPSSEYLPANVV 240

  Fly   259 PGSSYLPANILRRLR 273
            .|..|||.| |||.|
  Fly   241 AGQDYLPPN-LRRFR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 56/100 (56%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 56/99 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.