DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlS

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:203 Identity:67/203 - (33%)
Similarity:98/203 - (48%) Gaps:38/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 APNYAAPQAQLEKEFFTYTA-DEGDFYDPAASDR-VANAVNKGLRVVFIKGPENRGLEDAALALA 139
            |.|..:...:|..|:|||.| .|.|...|..|.| :|..::...:||||:.||.    :.....|
  Fly    37 AENEVSSGGKLATEYFTYAAPPEDDQVAPWQSARELAKVLSPPQQVVFIRTPET----NIFTLTA 97

  Fly   140 KQ-AAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQL 203
            || |......|:||::|||...||.:..:|:...:.||.|||||||||.|...|.||::..||:|
  Fly    98 KQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKYRTPADVTRALSALRSDYDRL 162

  Fly   204 GGSSQAQDGGVASTLNFASQPAPV---QAASSQAPAQFL-------------PASQPEATAPISS 252
            .|:|          ::.|.:.|.|   :..:::.|..|.             |||:.| ||.:.:
  Fly   163 PGNS----------ISHAIEKADVVQLKPQTTETPVIFKIRPKDSDYYETHEPASELE-TAKLQA 216

  Fly   253 ----YVPP 256
                |:||
  Fly   217 LFREYLPP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 40/103 (39%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.