DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlH

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster


Alignment Length:266 Identity:163/266 - (61%)
Similarity:188/266 - (70%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSG-SASSDAPAFAPAPSESFGPGPSSIADAL 69
            :.|||..||.||:   ||||||.|.:|:..||.||| |.|....|...||:|::.|     |.|.
  Fly     5 IALCLVAAVSARS---GYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAETYAP-----ASAP 61

  Fly    70 EGSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLEDA 134
            |.:.||.|.|||||||:|:||||||||||.||.:||.|.:|:.::||.|||:|||||||.|||:|
  Fly    62 EAAPSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENA 126

  Fly   135 ALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQ 199
            |:||||||.||||||||||||||||||:|||||||||||||||||||||||.:||.|||.|||.|
  Fly   127 AVALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQ 191

  Fly   200 YDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGSSYL 264
            ||||||||...:||||..||||||||..|.|:                        |:.||||||
  Fly   192 YDQLGGSSTILNGGVAPVLNFASQPAAQQVAA------------------------PSAPGSSYL 232

  Fly   265 PANILR 270
            ||::||
  Fly   233 PASVLR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 81/100 (81%)
TwdlHNP_651490.1 DM5 77..178 CDD:214776 81/100 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.