DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlN

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:335 Identity:174/335 - (51%)
Similarity:200/335 - (59%) Gaps:89/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQP-SGSAS------------SDAPAFAP 52
            ||.|.|   |||..:|.||||||||:||.||.|||||.| |||.|            |.......
  Fly     1 MRAFVV---LCLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLG 62

  Fly    53 APSESFGPGPSSIADALE---------------------------------------------GS 72
            ..|.|.|.|..|...:|:                                             ||
  Fly    63 GASGSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGLGSSGLGSGLGSSGLGSGLGS 127

  Fly    73 QSAAAP---NYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLEDA 134
            ...:||   |..||.|:|:||||||||:|.||.:|.|.:|||::|||||||||||||||||||:|
  Fly   128 AGLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGLENA 192

  Fly   135 ALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQ 199
            ||||||||||||||||||||||||||||.|||:||:|:|||||||||||||||||||||.|||.|
  Fly   193 ALALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRAIQSQ 257

  Fly   200 YDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGSSYL 264
            ||||||||||.:||||:.||||| ..||:.|::|.|.                        :|||
  Fly   258 YDQLGGSSQAINGGVANALNFAS-AGPVRQATAQIPE------------------------NSYL 297

  Fly   265 PANILRRLRF 274
            |:::|||||:
  Fly   298 PSSVLRRLRY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 84/100 (84%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 84/100 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.