DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlP

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:268 Identity:133/268 - (49%)
Similarity:160/268 - (59%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLCLCLAVLARADKL-GYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSIADALE 70
            ::.|.:...|.|..| ||||...|.:..|      ||..|..||.|         ||.|.:    
  Fly     4 LIILSIVAAASAGSLSGYNYGQGATTSIG------GSGVSPVPALA---------GPVSYS---- 49

  Fly    71 GSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLEDAA 135
                      |||||.:.|||:::.|::.||.|.||..|...:|.|.:||:|||.|||||.|:|.
  Fly    50 ----------AAPQASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAV 104

  Fly   136 LALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQY 200
            ||||||||||:||||||:||.||.:||.|.|::|.|.|.|||||||||||||||||||.|||.||
  Fly   105 LALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQY 169

  Fly   201 DQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGSSYLP 265
            ||||||||:.:||||:.:|||||.|        |||:..|...|:               |:|||
  Fly   170 DQLGGSSQSINGGVANAINFASQGA--------APARVTPQQVPQ---------------SNYLP 211

  Fly   266 ANILRRLR 273
            ||||.|||
  Fly   212 ANILSRLR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 62/100 (62%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 58/94 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.