DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlW

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:319 Identity:103/319 - (32%)
Similarity:137/319 - (42%) Gaps:65/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVL--CLCLAVLARAD----KLGYNY---------QP--VAH------------------ 30
            |:.|..||  .:||: |::||    :.||||         ||  |||                  
  Fly     1 MKIFVTVLMGAMCLS-LSQADISLTQAGYNYRIQQQQQQQQPPIVAHLLNQQLQQQQQLQPQQSS 64

  Fly    31 ----SPSGLSF-QPSGSASSDAPAFAPAPSESFGPG--PSSIADALEGSQSAAAPNYAAPQAQL- 87
                .|..|.: .|:|...|..||..|.......|.  |.:...|....|..|.|....|:..: 
  Fly    65 HPVLPPLPLPYLPPAGQFHSAQPAVRPTAGSFPMPAGFPVNFQTAPIQQQRRARPRVRIPKRPIV 129

  Fly    88 EKEFFTYTADEGDFYDPAASDRVANAVNK-------GLRVVFIKGP--ENRGLEDAALALAKQAA 143
            .|.||.::|.|      .:.|.|.:.:|:       ...|:|:|.|  .||.   |||.|||...
  Fly   130 TKNFFIHSAPE------ESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRA---AALNLAKTLK 185

  Fly   144 QQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQ 208
            |::|.:|||.|:....||.:.: :....:.|||||.|:||||||:|.|||..||.|||.|||||.
  Fly   186 QEKTVVYVLAKKTTASDLQDAI-AEAPQHINKPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSST 249

  Fly   209 AQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGSSYLPAN 267
            ..|.|||...:......|.:....:...|.....|.......:|.|.|.  |:.|||||
  Fly   250 ITDEGVAPITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPI--GNHYLPAN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 37/110 (34%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 37/109 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.