DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlG

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:294 Identity:90/294 - (30%)
Similarity:121/294 - (41%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASS----DAPAFAPAPSESF------------- 58
            ||..||.....|||||      :....|.|..|..    ..|.||....::.             
  Fly     8 CLLGLAAGIPQGYNYQ------AQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQAPKLQQV 66

  Fly    59 ---GPGPSSI-----ADALEGSQSAAAPN---YAAPQAQLEKEFFTYTADEGDFYDPA--ASDRV 110
               |.|.:|.     |.|.:...:...||   .|.|||...::....:.|......||  ..||.
  Fly    67 LTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEEPEDRY 131

  Fly   111 ANAV------NKGLRVVFIKGPENRGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIR 169
            ...|      .|..|:||||.| ...:..|||.:.:...:::|.||||.|:.|..||...:..|.
  Fly   132 PQPVLPPAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQTAIEEIA 195

  Fly   170 NNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQA 234
            ....:||||.|:||:|.|:||:||..||.|||||||:||..|.||          |||.:.....
  Fly   196 PKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGV----------APVTSVIGVL 250

  Fly   235 PAQFLPASQPEATAPISSYVPPATPGSSYLPANI 268
            ..|   .:...::...|..:|     :||||.|:
  Fly   251 DNQ---RNNGISSGQFSGSLP-----NSYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 34/108 (31%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.