DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlF

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:355 Identity:104/355 - (29%)
Similarity:154/355 - (43%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQP-------------VAHSPSGL-------SFQPSGS--- 42
            |:||.|::|| :|:.|.|.: ||.|||             ...|.||:       ||..:|:   
  Fly     1 MKQFVVLMCL-VALTATAPQ-GYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPA 63

  Fly    43 -------------ASSDAPAFAPA------PSESF---GPGPSSIADA---------LEGSQSAA 76
                         .::.|||.|||      |.|:|   .|..:.|:..         .:..|.|.
  Fly    64 IGVQPAIQAVQTIVAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQAL 128

  Fly    77 APNYAAPQAQLEKEFFTYTADEGD---FYDPAASDRVANAVNKGLRVVFIKGP-ENRGLEDAALA 137
            ...:....|.:.|:.:.::|.|.:   ..|....:.|  .:.|..|:||||.| :|.....|||.
  Fly   129 QTQFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENV--PIRKNYRIVFIKAPSQNLKYTAAALK 191

  Fly   138 LAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNN-NKPEVHFVKYRTPEDAANAQSAIQGQYD 201
            .|:.:.:::|.||||:|:.|:.::..:|...::... .||||:|:||:|.|:|..||..||.|||
  Fly   192 RAQSSNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYD 256

  Fly   202 QLGGSSQAQDGGVA-------STLNFAS-QPAPVQAAS----SQAPAQFLPASQP---------- 244
            .|||::...|.|||       .:||..| .|...||..    ||||....|..||          
  Fly   257 ALGGATHISDEGVAPIASVSSGSLNLGSFVPQHSQAGQTIIHSQAPTIIQPQGQPIVQLQSINQG 321

  Fly   245 -EATAPISSYV-------PPATPGSSYLPA 266
             :.....||:|       .|:.|...|:||
  Fly   322 VQGVQQQSSFVQKSTSSFAPSAPSRKYVPA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 33/105 (31%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.