DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlE

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:93/258 - (36%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSIADALE 70
            |::.|...|.||.:....:|.    :|...|:||||            ||..:|           
  Fly     9 VLMALAALVAARPEPPRDSYS----APPSSSYQPSG------------PSGGYG----------- 46

  Fly    71 GSQSAAAPNYAAPQAQ--LEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLED 133
                |.||.|..||..  :.|..:.:.......|.............|..::||||.| :..:..
  Fly    47 ----APAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAP-SPPVPT 106

  Fly   134 AALALAKQAAQQETAIYVLNK----QADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQS 194
            |.:.......:::|.:|||.|    |.:|     .:.:......:||||:|::|:|.::..    
  Fly   107 APVIPQFPQNEEKTLVYVLVKKPEEQPEI-----IIPTPAPTQPSKPEVYFIRYKTQKEET---- 162

  Fly   195 AIQGQYDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPA 257
               |.|.                 |..:.|||...|         ||:.|..:||.|||..|:
  Fly   163 ---GPYP-----------------NSVAPPAPEYGA---------PAAPPAPSAPSSSYGAPS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 22/106 (21%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 22/104 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.