DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlJ and TwdlX

DIOPT Version :9

Sequence 1:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:362 Identity:99/362 - (27%)
Similarity:145/362 - (40%) Gaps:107/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQFSVVLCLCLAVLA---------RAD---KLGYNYQPVAHSPS--------------GLSFQP 39
            |:||.|     |||||         |.|   ..||:||...::.:              ..|:||
  Fly     1 MKQFVV-----LAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAPLTTVTTSYQP 60

  Fly    40 SGSAS---SDAPAFAP------------------APSESFGPGPSSIAD-------ALEGSQSAA 76
            :.:.:   |.||:...                  :.|.|:..|.||:..       .|.|.|...
  Fly    61 TAAGTNYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGP 125

  Fly    77 APNYAAPQ-----------AQLEKEFFTYTADEGDFYDPAASDRVANA--VNKGLRVVFIKGPEN 128
            ..||...:           ||:.|.|:.::|.|.  :|.....|..|.  ..|..|||||..|.:
  Fly   126 TINYNEQESYISHLANFQPAQINKHFYIHSAPED--HDEQQIVRYVNVGRPQKNYRVVFINAPTS 188

  Fly   129 RGLEDAALALAKQA-AQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANA 192
            ..  ..|..:|..| .:::||||||:|:::..|:..::.:.| ...|||||.||||:||::||:|
  Fly   189 TA--SKAKIIANVAPVEEKTAIYVLSKKSNALDVTAEVVTQR-PVANKPEVFFVKYKTPQEAAHA 250

  Fly   193 QSAIQGQYDQLGGSSQAQ---------------DGGVASTLNFASQP--------APVQAASSQA 234
            |..||..||.|||||:..               |.|.:..|..||..        .|...|.:..
  Fly   251 QQTIQANYDALGGSSETSNEGVIPVSSVIGSLGDNGASGVLTDASGSVNIVGTGGVPTVDAGASY 315

  Fly   235 PAQFLPASQPEATAPISSYVPPATPGSSYLPANILRR 271
            .|:   .||.:.   ||:........::|||...:|:
  Fly   316 DAE---GSQRQV---ISTVTTGTNAQATYLPVKPVRK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlJNP_651489.2 DM5 85..186 CDD:214776 37/103 (36%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 33/97 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.