DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlT

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:300 Identity:62/300 - (20%)
Similarity:102/300 - (34%) Gaps:83/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATA-DKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIAD 64
            |::|:::..:|||.| .:.||||    :.|.|......||.......|....|..|..|   |..
  Fly     1 MKAFILMSCLALAAARPEAGYNY----NRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGG---IGG 58

  Fly    65 ALEGS----------QSAAAPNYAA---------------------------------------- 79
            ...|.          .|.....:::                                        
  Fly    59 GFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGG 123

  Fly    80 ---PQAQLEKEFFTYTADEGDFYDPSASDRVANAVN-------KGLRVVFIKGPENSGLEDAALA 134
               ....::|..:.:.       .|...:.|....|       |..:::|||.|.....:...:.
  Fly   124 GGGGTTLVQKHIYVHV-------PPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIP 181

  Fly   135 LAKQAAQQETAIYVL-NKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYD 198
            |..| .:::|.:||| .|..|..|:.  :.:......:||||:|:||:|.:|::.....|.|   
  Fly   182 LQPQ-NEEKTLVYVLVKKPEDQQDIV--IPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISG--- 240

  Fly   199 QLGGSSQSQNGGVASTLNFASQPAPRESTAASAPGPSYLP 238
            ..||.:|: |.|...|..........:|.:.|||..:|.|
  Fly   241 STGGFTQT-NTGNGYTSGGDGGFTGGDSGSISAPSSNYGP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 25/108 (23%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.