DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlC

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:317 Identity:70/317 - (22%)
Similarity:110/317 - (34%) Gaps:92/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSA----SSDAP--AFAPAPS----ASFAP 57
            |..|:| :|...|..||....|..:|..||..|.|..|    :...|  .:.|.|.    |:|||
  Fly     5 SLFVVC-VASLVATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFANFAP 68

  Fly    58 ------GPSSIADALE--------------------------GSQSAAAPNYAAPQAQLEKEFFT 90
                  .|....||:|                          |.|.|:..|....:.::.|..:.
  Fly    69 PQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGYNNGPQETKVHKHIYV 133

  Fly    91 YTADEGDFYDPSASDRVANAVN-------KGLRVVFIKGPENSGLEDAALALAKQAAQQETAIYV 148
            :...: ||.:   .|.:...|:       |..::||||.|....:....:....| .:::|.|||
  Fly   134 HVPPK-DFEE---EDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQ-NEEKTLIYV 193

  Fly   149 LNK----QADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQ---- 205
            |:|    :.||     .:.:......:||||:|:||:|.:|.|........:.:....:::    
  Fly   194 LHKKPEQEQDI-----VIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEMEPRQATAEDFAP 253

  Fly   206 -SQNGGVASTLNFASQPAP-----------------------RESTAASAPGPSYLP 238
             ::...|......|..|.|                       ...|..|||...|||
  Fly   254 LAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLSAPANQYLP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 27/111 (24%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.