DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and Tb

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651494.1 Gene:Tb / 43212 FlyBaseID:FBgn0243586 Length:283 Species:Drosophila melanogaster


Alignment Length:288 Identity:115/288 - (39%)
Similarity:151/288 - (52%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIADA 65
            ||.|::...:|:|.||..||||.....|...:|   .||.|..:.:.......|.:.|..|....
  Fly     1 MRGFIIFAVLAVARADVGGYNYGAGIGSGGSIS---GGSLSGGSISGGSISGGSISGGSISGGSI 62

  Fly    66 LEGSQSAA-------APNYAAPQAQLEKEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGP 123
            ..||.|:.       :.|||....:..||||||:|.|.||.|..:...:|..:.|.||||||:.|
  Fly    63 SGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAP 127

  Fly   124 ENSGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAAN 188
            ||.|||:||||||||||:|:||||||.||.|:..|||:|.::.:.:.:|||||||||||.:||.|
  Fly   128 ENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAIN 192

  Fly   189 AQSAIQGQYDQLGGSSQSQNGGVASTLNFASQ--------------------------------- 220
            ||..||.:|::|||:|.|.|||||..|:||::                                 
  Fly   193 AQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAEL 257

  Fly   221 --------PAPRESTAASAPGPSYLPAN 240
                    |.|     |:||..:|||.|
  Fly   258 EAPSAGYIPPP-----AAAPSATYLPVN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 59/100 (59%)
TbNP_651494.1 DM5 86..187 CDD:214776 59/100 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.